SDF-1α (CXCL12) labelled 15N and 13C for NMR (50 µg) [HM-161] SDF-1α for Mass Spectrometry is the 8 kDa protein labelled with isotope 15N and 13C . This protein is suitable for NMR studies. This product corresponds to the human sequence and is produced in E.coli. SDF-1α we provide is the natural protein, with no tags or additional amino acids. It has the sequence: MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDA Purity: The purified protein is >95% homogeneous (electrophoresis and mass spectrometry). It contains no nucleic acids. Endotoxin Level: The purified protein is free from LPS (Cambrex Limulus Amoebocyte Assay QCL-1000, <0.1 ng LPS per mg protein). Buffer: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) is lyophilized from DPBS without Ca and Mg. Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.